TNF (Canine) Recombinant Protein Ver mas grande

TNF (Canine) Recombinant Protein

AB-P9231

Producto nuevo

TNF (Canine) Recombinant Protein

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.


Hoja técnica

Size 20 ug
Gene Name TNF
Gene Alias TNFA|cTNF
Gene Description tumor necrosis factor (TNF superfamily, member 2)
Storage Conditions Lyophilized protein at room temperature for 3 weeks, should be stored at -20ºC. Protein aliquots at 4ºC for 2-7 days and should be stored at -20ºC to -80ºC. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). <br>Avoid repe
Immunogen Prot. Seq VKSSSRTPSDKPVAHVVANPEAEGQLQWLSRRANALLANGVELTDNQLIVPSDGLYLIYSQVLFKGQGCPSTHVLLTHTISRFAVSYQTKVNLLSAIKSPCQRETPEGTEAKPWYEPIYLGGVFQLEKGDRLSAEINLPNYLDFAESGQVYFGIIAL.
Form Lyophilized
Antigen species Target species Dog
Storage Buffer Protein (1 mg/mL) was lyophilized from a solution containing 1X PBS, pH 7.4. Reconstitute the lyophilized powder in ddH<sub>2</sub>O to 100 ug/mL.
Gene ID 403922

Más información

Canine TNF recombinant protein expressed in Escherichia coli.

Consulta sobre un producto

TNF (Canine) Recombinant Protein

TNF (Canine) Recombinant Protein