Ver mas grande
Tnf (Rat) Recombinant Protein
AB-P9228
Producto nuevo
Tnf (Rat) Recombinant Protein
Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.
Hoja técnica
| Size | 20 ug |
| Gene Name | Tnf |
| Gene Alias | MGC124630|RATTNF|TNF-alpha|Tnfa |
| Gene Description | tumor necrosis factor (TNF superfamily, member 2) |
| Storage Conditions | Store at 4ºC for 2-4 weeks and should be stored at -20ºC to -80ºC. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). <br>Avoid repeated freeze/thaw cycles. |
| Immunogen Prot. Seq | MGSSHHHHHHSSGLVPRGSHMGSHMLRSSSQNSSDKPVAHVVANHQAEEQLEWLSQRANALLANGMDLKDNQLVVPADGLYLIYSQVLFKGQGCPDYVLLTHTVSRFAISYQEKVSLLSAIKSPCPKDTPEGAELKPWYEPMYLGGVFQLEKGDLLSAEVNLPKYLDITESGQVYFGVIAL |
| Form | Liquid |
| Antigen species Target species | Rat |
| Storage Buffer | Solution (1 mg/mL) containing 1X PBS, pH 7.4, 10% glycerol, 1 mM DTT. |
| Gene ID | 24835 |
Más información
Rat Tnf partial recombinant protein with His tag in N-terminus expressed in Escherichia coli.