Tnf (Rat) Recombinant Protein
  • Tnf (Rat) Recombinant Protein

Tnf (Rat) Recombinant Protein

Ref: AB-P9228
Tnf (Rat) Recombinant Protein

Información del producto

Rat Tnf partial recombinant protein with His tag in N-terminus expressed in Escherichia coli.
Información adicional
Size 20 ug
Gene Name Tnf
Gene Alias MGC124630|RATTNF|TNF-alpha|Tnfa
Gene Description tumor necrosis factor (TNF superfamily, member 2)
Storage Conditions Store at 4C for 2-4 weeks and should be stored at -20C to -80C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Avoid repeated freeze/thaw cycles.
Application Key SDS-PAGE
Immunogen Prot. Seq MGSSHHHHHHSSGLVPRGSHMGSHMLRSSSQNSSDKPVAHVVANHQAEEQLEWLSQRANALLANGMDLKDNQLVVPADGLYLIYSQVLFKGQGCPDYVLLTHTVSRFAISYQEKVSLLSAIKSPCPKDTPEGAELKPWYEPMYLGGVFQLEKGDLLSAEVNLPKYLDITESGQVYFGVIAL
Form Liquid
Antigen species Target species Rat
Storage Buffer Solution (1 mg/mL) containing 1X PBS, pH 7.4, 10% glycerol, 1 mM DTT.
Gene ID 24835

Enviar un mensaje


Tnf (Rat) Recombinant Protein

Tnf (Rat) Recombinant Protein