AB-P9228
Producto nuevo
Este producto ya no esta disponible
Fecha disponibilidad
Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.
Size | 20 ug |
Gene Name | Tnf |
Gene Alias | MGC124630|RATTNF|TNF-alpha|Tnfa |
Gene Description | tumor necrosis factor (TNF superfamily, member 2) |
Storage Conditions | Store at 4ºC for 2-4 weeks and should be stored at -20ºC to -80ºC. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). <br>Avoid repeated freeze/thaw cycles. |
Immunogen Prot. Seq | MGSSHHHHHHSSGLVPRGSHMGSHMLRSSSQNSSDKPVAHVVANHQAEEQLEWLSQRANALLANGMDLKDNQLVVPADGLYLIYSQVLFKGQGCPDYVLLTHTVSRFAISYQEKVSLLSAIKSPCPKDTPEGAELKPWYEPMYLGGVFQLEKGDLLSAEVNLPKYLDITESGQVYFGVIAL |
Form | Liquid |
Antigen species Target species | Rat |
Storage Buffer | Solution (1 mg/mL) containing 1X PBS, pH 7.4, 10% glycerol, 1 mM DTT. |
Gene ID | 24835 |