Tgfb1 (Mouse) Recombinant Protein
  • Tgfb1 (Mouse) Recombinant Protein

Tgfb1 (Mouse) Recombinant Protein

Ref: AB-P9206
Tgfb1 (Mouse) Recombinant Protein

Información del producto

Mouse Tgfb1 partial recombinant protein with His tag in N-terminus expressed in Escherichia coli.
Información adicional
Size 2 x 10 ug
Gene Name Tgfb1
Gene Alias TGF-beta1|TGFbeta1|Tgfb|Tgfb-1
Gene Description transforming growth factor, beta 1
Storage Conditions Store at 4C for 2-4 weeks and should be stored at -20C to -80C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Avoid repeated freeze/thaw cycles.
Application Key SDS-PAGE
Immunogen Prot. Seq MGSSHHHHHHSSGLVPRGSHMGSALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASASPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS
Form Liquid
Antigen species Target species Mouse
Storage Buffer Solution (0.25 mg/mL) containing 20 mM Tris-HCl, pH 8.0, 10% glycerol.
Gene ID 21803

Enviar un mensaje


Tgfb1 (Mouse) Recombinant Protein

Tgfb1 (Mouse) Recombinant Protein