Tgfb1 (Mouse) Recombinant Protein Ver mas grande

Tgfb1 (Mouse) Recombinant Protein

AB-P9206

Producto nuevo

Tgfb1 (Mouse) Recombinant Protein

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 4 Biopuntos. Su cesta contiene un total 4 Biopuntos puede ser convertido en un Biobonos Descuento 16.00EUR.


Hoja técnica

Size 2 x 10 ug
Gene Name Tgfb1
Gene Alias TGF-beta1|TGFbeta1|Tgfb|Tgfb-1
Gene Description transforming growth factor, beta 1
Storage Conditions Store at 4ºC for 2-4 weeks and should be stored at -20ºC to -80ºC. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). <br>Avoid repeated freeze/thaw cycles.
Immunogen Prot. Seq MGSSHHHHHHSSGLVPRGSHMGSALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASASPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS
Form Liquid
Antigen species Target species Mouse
Storage Buffer Solution (0.25 mg/mL) containing 20 mM Tris-HCl, pH 8.0, 10% glycerol.
Gene ID 21803

Más información

Mouse Tgfb1 partial recombinant protein with His tag in N-terminus expressed in Escherichia coli.

Consulta sobre un producto

Tgfb1 (Mouse) Recombinant Protein

Tgfb1 (Mouse) Recombinant Protein