TGFB1 (Human) Recombinant Protein
  • TGFB1 (Human) Recombinant Protein

TGFB1 (Human) Recombinant Protein

Ref: AB-P9205
TGFB1 (Human) Recombinant Protein

Información del producto

Human TGFB1 partial recombinant protein expressed in Escherichia coli.
Información adicional
Size 2 x 10 ug
Gene Name TGFB3
Gene Alias ARVD|FLJ16571|TGF-beta3
Gene Description transforming growth factor, beta 3
Storage Conditions Store at 4C for 2-4 weeks and should be stored at -20C to -80C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Avoid repeated freeze/thaw cycles.
Specificity TGFB1 (113 a.a.) Human
Application Key SDS-PAGE
Immunogen Prot. Seq MALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS
Form Liquid
Antigen species Target species Human
Storage Buffer Solution containing 10 mM Sodium Citrate, pH3.5, 10% glycerol.
Gene ID 7043

Enviar un mensaje


TGFB1 (Human) Recombinant Protein

TGFB1 (Human) Recombinant Protein