Ver mas grande
TGFB1 (Human) Recombinant Protein
AB-P9202
Producto nuevo
TGFB1 (Human) Recombinant Protein
Comprando este producto generará 4 Biopuntos. Su cesta contiene un total 4 Biopuntos puede ser convertido en un Biobonos Descuento 16.00EUR.
Hoja técnica
| Size | 2 x 10 ug |
| Gene Name | TGFB1 |
| Gene Alias | CED|DPD1|TGFB|TGFbeta |
| Gene Description | transforming growth factor, beta 1 |
| Storage Conditions | Lyophilized protein at room temperature for 3 weeks, should be stored at -20ºC. Protein aliquots at 4ºC for 2-7 days and should be stored at -20ºC to -80ºC. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). <br>Avoid repe |
| Specificity | TGFB1 Human Recombinant |
| Immunogen Prot. Seq | ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS |
| Form | Lyophilized |
| Antigen species Target species | Human |
| Storage Buffer | Lyophilized from a solution containing 0.1% TFA and trehalose (1:20 protein to Trehalose ratio). Reconstitute the lyophilized powder in 10 mM HCl to 0.1 mg/mL. |
| Gene ID | 7040 |
Más información
Human TGFB1 recombinant protein expressed in CHO cells.