Ver mas grande
TNFRSF13B (Human) Recombinant Protein
AB-P9190
Producto nuevo
TNFRSF13B (Human) Recombinant Protein
Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.
Hoja técnica
| Size | 20 ug |
| Gene Name | TNFRSF13B |
| Gene Alias | CD267|CVID|FLJ39942|MGC133214|MGC39952|TACI|TNFRSF14B |
| Gene Description | tumor necrosis factor receptor superfamily, member 13B |
| Storage Conditions | Store at 4ºC for 2-4 weeks and should be stored at -20ºC to -80ºC. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). <br>Avoid repeated freeze/thaw cycles. |
| Specificity | TACI Human, His |
| Immunogen Prot. Seq | MGSSHHHHHHSSGLVPRGSHMGSMSGLGRSRRGGRSRVDQEERFPQGLWTGVAMRSCPEEQYWDPLLGTCMSCKTICNHQSQRTCAAFCRSLSCRKEQGKFYDHLLRDCISCASICGQHPKQCAYFCENKLRSPVNLPPELRRQRSGEVENNSDNSGRYQGLEHRGSEASPALPGLKLSADQVALVYS |
| Form | Liquid |
| Antigen species Target species | Human |
| Storage Buffer | Solution (1 mg/mL) containing 20 mM Tris-HCl, pH 8.0, 10% glycerol, 0.4 M Urea. |
| Gene ID | 23495 |
Más información
Human TNFRSF13B full-length recombinant protein with His tag in N-terminus expressed in Escherichia coli.