Ver mas grande
SPP1 (Human) Recombinant Protein
AB-P9187
Producto nuevo
SPP1 (Human) Recombinant Protein
Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.
Hoja técnica
| Size | 20 ug |
| Gene Name | SPP1 |
| Gene Alias | BNSP|BSPI|ETA-1|MGC110940|OPN |
| Gene Description | secreted phosphoprotein 1 |
| Storage Conditions | Store at 4ºC for 2-4 weeks. Store at -20ºC for long term storage, it is recommended to add a carrier protein (0.1% HSA or BSA). <br>Avoid repeated freeze/thaw cycles. |
| Specificity | SPP1 Human, Active |
| Immunogen Prot. Seq | MGSSHHHHHHSSGLVPRGSHRSMIPVKQADSGSSEEKQLYNKYPDAVATWLNPDPSQKQNLLAPQNAVSSEETNDFKQETLPSKSNESHDHMDDMDDEDDDDHVDSQDSIDSNDSDDVDDTDDSHQSDESHHSDESDELVTDFPTDLPATEVFTPVVPTVDTYDGRGDSVVYGLRSKSKKFRRPDIQYPDATDEDITSHMESEELNGAYKAIPVAQDLNAPSDWDSRGKDSYETSQLDDQSAETHSHKQSRLYKR |
| Form | Liquid |
| Antigen species Target species | Human |
| Storage Buffer | Solution (1 mg/mL) containing 20 mM Tris-HCl, pH 7.5, 10% glycerol, 2 mM EDTA, 1 mM DTT. |
| Gene ID | 6696 |
Más información
Human SPP1 partial recombinant protein with His tag in N-terminus expressed in Escherichia coli.