Ver mas grande
SAA4 (Human) Recombinant Protein
AB-P9177
Producto nuevo
SAA4 (Human) Recombinant Protein
Comprando este producto generará 4 Biopuntos. Su cesta contiene un total 4 Biopuntos puede ser convertido en un Biobonos Descuento 16.00EUR.
Hoja técnica
| Size | 2 x 10 ug |
| Gene Name | SAA4 |
| Gene Alias | C-SAA|CSAA |
| Gene Description | serum amyloid A4, constitutive |
| Storage Conditions | Store at 4ºC for 2-4 weeks and should be stored at -20ºC to -80ºC. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). <br>Avoid repeated freeze/thaw cycles. |
| Immunogen Prot. Seq | MGSSHHHHHHSSGLVPRGSHMWRSFFKEALQGVGDMGRAYWDIMISNHQNSNRYLYARGNYDAAQRGPGGVWAAKLISRSRVYLQGLIDYYLFGNSSTVLEDSKSNEKAEEWGRSGKDPDRFRPDGLPKKY |
| Form | Liquid |
| Antigen species Target species | Human |
| Storage Buffer | Solution (0.5 mg/mL) containing 20 mM Tris-HCl, pH 8.0, 20% glycerol, 200 mM NaCl, 5 mM DTT, 0.5 mM EDTA. |
| Gene ID | 6291 |
Más información
Human SAA4 partial recombinant protein with His tag in N-terminus expressed in Escherichia coli.