SAA1 (Human) Recombinant Protein
  • SAA1 (Human) Recombinant Protein

SAA1 (Human) Recombinant Protein

Ref: AB-P9175
SAA1 (Human) Recombinant Protein

Información del producto

Human SAA1 partial recombinant protein with His tag in N-terminus expressed in Escherichia coli.
Información adicional
Size 50 ug
Gene Name SAA1
Gene Alias MGC111216|PIG4|SAA|TP53I4
Gene Description serum amyloid A1
Storage Conditions Store at 4C for 2-4 weeks and should be stored at -20C to -80C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Avoid repeated freeze/thaw cycles.
Application Key SDS-PAGE
Immunogen Prot. Seq MGSSHHHHHHSSGLVPRGSHMRSFFSFLGEAFDGARDMWRAYSDMREANYIGSDKYFHARGNYDAAKRGPGGVWAAEAISDARENIQRFFGHGAEDSLADQAANEWGRSGKDPNHFRPAGLPEKY
Form Liquid
Antigen species Target species Human
Storage Buffer Solution containing 20 mM Tris-HCl, pH 8.0, 10% glycerol.
Gene ID 6288

Enviar un mensaje


SAA1 (Human) Recombinant Protein

SAA1 (Human) Recombinant Protein