Ver mas grande
SAA1 (Human) Recombinant Protein
AB-P9175
Producto nuevo
SAA1 (Human) Recombinant Protein
Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.
Hoja técnica
| Size | 50 ug |
| Gene Name | SAA1 |
| Gene Alias | MGC111216|PIG4|SAA|TP53I4 |
| Gene Description | serum amyloid A1 |
| Storage Conditions | Store at 4ºC for 2-4 weeks and should be stored at -20ºC to -80ºC. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). <br>Avoid repeated freeze/thaw cycles. |
| Immunogen Prot. Seq | MGSSHHHHHHSSGLVPRGSHMRSFFSFLGEAFDGARDMWRAYSDMREANYIGSDKYFHARGNYDAAKRGPGGVWAAEAISDARENIQRFFGHGAEDSLADQAANEWGRSGKDPNHFRPAGLPEKY |
| Form | Liquid |
| Antigen species Target species | Human |
| Storage Buffer | Solution containing 20 mM Tris-HCl, pH 8.0, 10% glycerol. |
| Gene ID | 6288 |
Más información
Human SAA1 partial recombinant protein with His tag in N-terminus expressed in Escherichia coli.