Retn (Rat) Recombinant Protein
  • Retn (Rat) Recombinant Protein

Retn (Rat) Recombinant Protein

Ref: AB-P9163
Retn (Rat) Recombinant Protein

Información del producto

Rat Retn recombinant protein with His tag in N-terminus expressed in Escherichia coli.
Información adicional
Size 25 ug
Gene Name Retn
Gene Alias -
Gene Description resistin
Storage Conditions Lyophilized protein should be stored at -20C. Protein aliquots at 4C for 2 weeks.
Avoid repeated freeze/thaw cycles.
Application Key SDS-PAGE
Immunogen Prot. Seq MRGSHHHHHHGMASHMPSMSLCPMDEAISKKINQDFSSLLPAAMKNTVLHCWSVSSRGRLASCPEGTTVTSCSCGSGCGSWDVREDTMCHCQCGSIDWTAARCCTLRVGS
Form Lyophilized
Antigen species Target species Rat
Storage Buffer Protein (0.5 mg/mL) was lyophilized from a solution containing 20 mM Tris-HCl, pH 8.0. Reconstitute the lyophilized powder in ddH2O to 0.5mg/mL and let the lyophilized pellet dissolve completely, and is not sterile! Please filter the product by
Gene ID 246250

Enviar un mensaje


Retn (Rat) Recombinant Protein

Retn (Rat) Recombinant Protein