Retn (Rat) Recombinant Protein Ver mas grande

Retn (Rat) Recombinant Protein

AB-P9163

Producto nuevo

Retn (Rat) Recombinant Protein

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.


Hoja técnica

Size 25 ug
Gene Name Retn
Gene Alias -
Gene Description resistin
Storage Conditions Lyophilized protein should be stored at -20ºC. Protein aliquots at 4ºC for 2 weeks. <br>Avoid repeated freeze/thaw cycles.
Immunogen Prot. Seq MRGSHHHHHHGMASHMPSMSLCPMDEAISKKINQDFSSLLPAAMKNTVLHCWSVSSRGRLASCPEGTTVTSCSCGSGCGSWDVREDTMCHCQCGSIDWTAARCCTLRVGS
Form Lyophilized
Antigen species Target species Rat
Storage Buffer Protein (0.5 mg/mL) was lyophilized from a solution containing 20 mM Tris-HCl, pH 8.0. Reconstitute the lyophilized powder in ddH<sub>2</sub>O to 0.5mg/mL and let the lyophilized pellet dissolve completely, and is not sterile! Please filter the product by
Gene ID 246250

Más información

Rat Retn recombinant protein with His tag in N-terminus expressed in Escherichia coli.

Consulta sobre un producto

Retn (Rat) Recombinant Protein

Retn (Rat) Recombinant Protein