Retn (Mouse) Recombinant Protein
  • Retn (Mouse) Recombinant Protein

Retn (Mouse) Recombinant Protein

Ref: AB-P9160
Retn (Mouse) Recombinant Protein

Información del producto

Mouse Retn recombinant protein expressed in Escherichia coli.
Información adicional
Size 25 ug
Gene Name Retn
Gene Alias ADSF|Fizz3|Rstn|Xcp4
Gene Description resistin
Storage Conditions Lyophilized protein at room temperature for 3 weeks, should be stored at -20C. Protein aliquots at 4C for 2-7 days and should be stored at -20C to -80C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Avoid repeated
Application Key SDS-PAGE
Immunogen Prot. Seq MSSMPLCPIDEAIDKKIKQDFNSLFPNAIKNIGLNCWTVSSRGKLASCPEGTAVLSCSCGSACGSWDIREEKVCHCQCARIDWTAARCCKLQVAS
Form Lyophilized
Antigen species Target species Mouse
Storage Buffer Lyophilized from a solution containing 0.1% TFA. Reconstitute the lyophilized powder in ddH2O to 100 ug/mL.
Gene ID 57264

Enviar un mensaje


Retn (Mouse) Recombinant Protein

Retn (Mouse) Recombinant Protein