RETN (Human) Recombinant Protein
  • RETN (Human) Recombinant Protein

RETN (Human) Recombinant Protein

Ref: AB-P9156
RETN (Human) Recombinant Protein

Información del producto

Human RETN recombinant protein expressed in Escherichia coli.
Información adicional
Size 25 ug
Gene Name RETN
Gene Alias ADSF|FIZZ3|MGC126603|MGC126609|RETN1|RSTN|XCP1
Gene Description resistin
Storage Conditions Lyophilized protein should be stored at -20C. Protein aliquots at 4C for 2 weeks.
Avoid repeated freeze/thaw cycles.
Application Key SDS-PAGE
Immunogen Prot. Seq MSSKTLCSMEEAINERIQEVAGSLIFRAISSIGLECQSVTSRGDLATCPRGFAVTGCTCGSACGSWDVRAETTCHCQCAGMDWTGARCCRVQP
Form Lyophilized
Antigen species Target species Human
Storage Buffer Lyophilized from a solution containing 0.1% TFA. Reconstitute the lyophilized powder in ddH2O to 100 ug/mL.
Gene ID 56729

Enviar un mensaje


RETN (Human) Recombinant Protein

RETN (Human) Recombinant Protein