Retnlg (Mouse) Recombinant Protein Ver mas grande

Retnlg (Mouse) Recombinant Protein

AB-P9153

Producto nuevo

Retnlg (Mouse) Recombinant Protein

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.


Hoja técnica

Size 25 ug
Gene Name Retnlg
Gene Alias Fizz3|Relmg|Xcp1
Gene Description resistin like gamma
Storage Conditions Lyophilized protein at room temperature for 3 weeks, should be stored at -20ºC. Protein aliquots at 4ºC for 2-7 days and should be stored at -20ºC to -80ºC. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). <br>Avoid repe
Immunogen Prot. Seq MEGTLESIVEKKVKELLANRDDCPSTVTKTFSCTSITASGRLASCPSGMTVTGCACGYGCGSWDIRDGNTCHCQCSTMDWATARCCQLA
Form Lyophilized
Antigen species Target species Mouse
Storage Buffer Lyophilized from a solution containing 0.1% TFA. Reconstitute the lyophilized powder in ddH<sub>2</sub>O to 100 ug/mL.
Gene ID 245195
Iso type Escherichia Coli.

Más información

Mouse Retnlg recombinant protein expressed in Escherichia coli.

Consulta sobre un producto

Retnlg (Mouse) Recombinant Protein

Retnlg (Mouse) Recombinant Protein