Ver mas grande
Retnla (Mouse) Recombinant Protein
AB-P9149
Producto nuevo
Retnla (Mouse) Recombinant Protein
Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.
Hoja técnica
| Size | 25 ug |
| Gene Name | Retnla |
| Gene Alias | 1810019L16Rik|Fizz-1|Fizz1|HIMF|RELM-alpha|RELMa|RELMalpha|Xcp2 |
| Gene Description | resistin like alpha |
| Storage Conditions | Lyophilized protein should be stored at -20ºC. Protein aliquots at 4ºC for 2 weeks. <br>Avoid repeated freeze/thaw cycles. |
| Immunogen Prot. Seq | MKKLLFAIPLVVPFYSHSTMVNTDETIEIIVENKVKELLANPANYPSTVTTLSCTSVKTMNRWASCPAGMTATGCACGFACGSWEIQSGDTCNCLCLLVDWTTARCCQLSLEDYKDDDDK |
| Form | Lyophilized |
| Antigen species Target species | Mouse |
| Storage Buffer | Protein (0.5 mg/mL) was lyophilized from a solution containing 5 mM Tris-HCl, pH 7.5, 25 mM NaCl. Reconstitute the lyophilized powder in ddH<sub>2</sub>O and let the lyophilized pellet dissolve completely. |
| Gene ID | 57262 |
| Iso type | Escherichia Coli. |
Más información
Mouse Retnla partial recombinant protein with flagTag in N-terminus expressed in Escherichia coli.