TNFRSF11A (Human) Recombinant Protein
  • TNFRSF11A (Human) Recombinant Protein

TNFRSF11A (Human) Recombinant Protein

Ref: AB-P9140
TNFRSF11A (Human) Recombinant Protein

Información del producto

Human TNFRSF11A partial recombinant protein with hIgG-His tag in C-terminus expressed in Baculovirus cells.
Información adicional
Size 2 x 10 ug
Gene Name TNFRSF11A
Gene Alias CD265|FEO|LOH18CR1|ODFR|OFE|OPTB7|OSTS|PDB2|RANK|TRANCER
Gene Description tumor necrosis factor receptor superfamily, member 11a, NFKB activator
Storage Conditions Store at 4C for 2-4 weeks and should be stored at -20C to -80C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Avoid repeated freeze/thaw cycles.
Application Key SDS-PAGE
Immunogen Prot. Seq ADPLQIAPPCTSEKHYEHLGRCCNKCEPGKYMSSKCTTTSDSVCLPCGPDEYLDSWNEEDKCLLHKVCDTGKALVAVVAGNSTTPRRCACTAGYHWSQDCECCRRNTECAPGLGAQHPLQLNKDTVCKPCLAGYFSDAFSSTDKCRPWTNCTFLGKRVEHHGTEKSDAVCSSSLPARKPPNEPHVYLPLEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDG
Form Liquid
Antigen species Target species Human
Storage Buffer Solution (1 mg/mL) containing 1X PBS, pH 7.4, 10% glycerol.
Gene ID 8792
Iso type Sf9, Baculovirus cells.

Enviar un mensaje


TNFRSF11A (Human) Recombinant Protein

TNFRSF11A (Human) Recombinant Protein