DHH (Human) Recombinant Protein
  • DHH (Human) Recombinant Protein

DHH (Human) Recombinant Protein

Ref: AB-P9136
DHH (Human) Recombinant Protein

Información del producto

Human DHH partial recombinant protein with His tag in N-terminus expressed in Escherichia coli.
Información adicional
Size 25 ug
Gene Name DHH
Gene Alias HHG-3|MGC35145
Gene Description desert hedgehog homolog (Drosophila)
Storage Conditions Store at 4C for 2-4 weeks and should be stored at -20C to -80C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Avoid repeated freeze/thaw cycles.
Application Key SDS-PAGE
Immunogen Prot. Seq MGSSHHHHHHSSGLVPRGSHMCGPGRGPVGRRRYARKQLVPLLYKQFVPGVPERTLGASGPAEGRVARGSERFRDLVPNYNPDIIFKDEENSGADRLMTERCKERVNALAIAVMNMWPGVRLRVTEGWDEDGHHAQDSLHYEGRALDITTSDRDRNKYGLLARLAVEAGFDWVYYESRNHVHVSVKADNSLAVRAGG
Form Liquid
Antigen species Target species Human
Storage Buffer Solution containing 20 mM MES ,pH 5.5, 20% glycerol, 0.5 mM DTT.
Gene ID 50846
Iso type Escherichia Coli.

Enviar un mensaje


DHH (Human) Recombinant Protein

DHH (Human) Recombinant Protein