Shh (Mouse) Recombinant Protein
  • Shh (Mouse) Recombinant Protein

Shh (Mouse) Recombinant Protein

Ref: AB-P9134
Shh (Mouse) Recombinant Protein

Información del producto

Mouse Shh partial recombinant protein with His tag in C-terminus expressed in Escherichia coli.
Información adicional
Size 25 ug
Gene Name Shh
Gene Alias 9530036O11Rik|Dsh|Hhg1|Hx|Hxl3|M100081
Gene Description sonic hedgehog
Storage Conditions Store at 4C for 2-4 weeks and should be stored at -20C to -80C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Avoid repeated freeze/thaw cycles.
Application Key SDS-PAGE
Immunogen Prot. Seq MCGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKTLGASGRYEGKITRNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDKLNALAISVMNQWPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRSKYGMLARLAVEAGFDWVYYESKAHIHCSVKAENSVAAKSGGLEHHHHHH
Form Liquid
Antigen species Target species Mouse
Storage Buffer Solution containing 20 mM Tris-HCl, pH 8.0, 10% glycerol, 1 mM DTT.
Gene ID 20423
Iso type Escherichia Coli.

Enviar un mensaje


Shh (Mouse) Recombinant Protein

Shh (Mouse) Recombinant Protein