Idioma:
Español
Español
Português
Español
Português
Buscar
Iniciar sesión
REACTIVOS
INSTRUMENTOS
CONSUMIBLES
OFERTAS
DESTACADOS
FABRICANTES
PUBLICACIONES CIENTÍFICAS
DESCARGAS
NEWSLETTERS
BIOGEN Científica
Reactivos
ABNOVA
Protein
CD84 (Human) Recombinant Protein
Abnova
CD84 (Human) Recombinant Protein
Ref: AB-P9110
CD84 (Human) Recombinant Protein
Contáctenos
Información del producto
Human CD84 (Q9UIB8, 22 a.a. - 225 a.a.) partial-length recombinant protein with His tag at N-Terminus expressed in
Escherichia coli
.
Información adicional
Size
20 ug
Gene Name
CD84
Gene Alias
DKFZp781E2378|LY9B|SLAMF5|hCD84|mCD84
Gene Description
CD84 molecule
Storage Conditions
Store at -20C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles.
Application Key
SDS-PAGE
Immunogen Prot. Seq
MGSSHHHHHHSSGLVPRGSHMGSHMKDSEIFTVNGILGESVTFPVNIQEPRQVKIIAWTSKTSVAYVTPGDSETAPVVTVTHRNYYERIHALGPNYNLVISDLRMEDAGDYKADINTQADPYTTTKRYNLQIYRRLGKPKITQSLMASVNSTCNVTLTCSVEKEEKNVTYNWSPLGEEGNVLQIFQTPEDQELTYTCTAQNPVSNNSDSISARQLCADIAMGFRTHHTG.
Form
Liquid
Antigen species Target species
Human
Storage Buffer
20mM Tris-HCl buffer (pH 8.0), 0.4M urea and 10% glycerol.
Gene ID
8832
Enviar un mensaje
CD84 (Human) Recombinant Protein
Nombre
*
Apellidos
*
Correo electrónico
*
Centro de Investigación
*
Departamento
Teléfono de Contacto
*
Mensaje de consulta sobre el producto
*