Ver mas grande
CD84 (Human) Recombinant Protein
AB-P9110
Producto nuevo
CD84 (Human) Recombinant Protein
Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.
Hoja técnica
| Size | 20 ug |
| Gene Name | CD84 |
| Gene Alias | DKFZp781E2378|LY9B|SLAMF5|hCD84|mCD84 |
| Gene Description | CD84 molecule |
| Storage Conditions | Store at -20ºC. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles. |
| Immunogen Prot. Seq | MGSSHHHHHHSSGLVPRGSHMGSHMKDSEIFTVNGILGESVTFPVNIQEPRQVKIIAWTSKTSVAYVTPGDSETAPVVTVTHRNYYERIHALGPNYNLVISDLRMEDAGDYKADINTQADPYTTTKRYNLQIYRRLGKPKITQSLMASVNSTCNVTLTCSVEKEEKNVTYNWSPLGEEGNVLQIFQTPEDQELTYTCTAQNPVSNNSDSISARQLCADIAMGFRTHHTG. |
| Form | Liquid |
| Antigen species Target species | Human |
| Storage Buffer | 20mM Tris-HCl buffer (pH 8.0), 0.4M urea and 10% glycerol. |
| Gene ID | 8832 |
Más información
Human CD84 (Q9UIB8, 22 a.a. - 225 a.a.) partial-length recombinant protein with His tag at N-Terminus expressed in Escherichia coli.