Idioma:
Español
Español
Português
Español
Português
Buscar
Iniciar sesión
REACTIVOS
INSTRUMENTOS
CONSUMIBLES
OFERTAS
DESTACADOS
FABRICANTES
PUBLICACIONES CIENTÍFICAS
DESCARGAS
NEWSLETTERS
BIOGEN Científica
Reactivos
ABNOVA
Protein
CD79B (Human) Recombinant Protein
Abnova
CD79B (Human) Recombinant Protein
Ref: AB-P9106
CD79B (Human) Recombinant Protein
Contáctenos
Información del producto
Human CD79B (P40259, 29 a.a. - 159 a.a.) partial-length recombinant protein with His tag at C-Terminus expressed in
Baculovirus
.
Información adicional
Size
2 x 10 ug
Gene Name
CD79B
Gene Alias
B29|IGB
Gene Description
CD79b molecule, immunoglobulin-associated beta
Storage Conditions
Store at -20C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles.
Application Key
SDS-PAGE
Immunogen Prot. Seq
ADPARSEDRYRNPKGSACSRIWQSPRFIARKRGFTVKMHCYMNSASGNVSWLWKQEMDENPQQLKLEKGRMEESQNESLATLTIQGIRFEDNGIYFCQQKCNNTSEVYQGCGTELRVMGFSTLAQLKQRNTLKDHHHHHH.
Form
Liquid
Antigen species Target species
Human
Storage Buffer
PBS (pH7.4) and 10% glycerol.
Gene ID
974
Enviar un mensaje
CD79B (Human) Recombinant Protein
Nombre
*
Apellidos
*
Correo electrónico
*
Centro de Investigación
*
Departamento
Teléfono de Contacto
*
Mensaje de consulta sobre el producto
*