CD72 (Human) Recombinant Protein
  • CD72 (Human) Recombinant Protein

CD72 (Human) Recombinant Protein

Ref: AB-P9103
CD72 (Human) Recombinant Protein

Información del producto

Human CD72 (P21854, 117 a.a. - 359 a.a.) partial-length recombinant protein with His tag at C-Terminus expressed in Baculovirus.
Información adicional
Size 2 x 10 ug
Gene Name CD72
Gene Alias CD72b|LYB2
Gene Description CD72 molecule
Storage Conditions Store at -20C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles.
Application Key SDS-PAGE
Immunogen Prot. Seq ADPRYLQVSQQLQQTNRVLEVTNSSLRQQLRLKITQLGQSAEDLQGSRRELAQSQEALQVEQRAHQAAEGQLQACQADRQKTKETLQSEEQQRRALEQKLSNMENRLKPFFTCGSADTCCPSGWIMHQKSCFYISLTSKNWQESQKQCETLSSKLATFSEIYPQSHSYYFLNSLLPNGGSGNSYWTGLSSNKDWKLTDDTQRTRTYAQSSKCNKVHKTWSWWTLESESCRSSLPYICEMTAFRFPDLEPKSCDKT
Form Liquid
Antigen species Target species Human
Storage Buffer 50mM Tris-HCl buffer (pH6.8), 0.2M NaCl, 2mM DTT and 50% glycerol.
Gene ID 971

Enviar un mensaje


CD72 (Human) Recombinant Protein

CD72 (Human) Recombinant Protein