Ver mas grande
CD68 (Human) Recombinant Protein
AB-P9098
Producto nuevo
CD68 (Human) Recombinant Protein
Comprando este producto generará 4 Biopuntos. Su cesta contiene un total 4 Biopuntos puede ser convertido en un Biobonos Descuento 16.00EUR.
Hoja técnica
| Size | 2 x 10 ug |
| Gene Name | CD68 |
| Gene Alias | DKFZp686M18236|GP110|SCARD1 |
| Gene Description | CD68 molecule |
| Storage Conditions | Store at -20ºC. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles. |
| Immunogen Prot. Seq | MGSSHPLHHHSSGLVPRGSHMGSHMNDCPHKKSATLLPSFTVTPTVTESTGTTSHRTTKSHKTTTHRTTTTGTTSHGPTTATHNPTTTSHGNVTVHPTSNSTATSQGPSTATHSPATTSHGNATVHPTSNSTATSPGFTSSAHPEPPPPSPSPSPTSKETIGDYTWTNGSQPCVHLQAQIQIRVMYTTQGGGEAWGISVLNPNKTKVQGSCEGAHPHLLLSFPYGHLSFGFMQDLQQKVVYLSYMAVEYNVSFPH |
| Form | Liquid |
| Antigen species Target species | Human |
| Storage Buffer | 20mM Tris-HCl buffer (pH 8.0), 0.1M NaCl, 1M Urea and 10% glycerol. |
| Gene ID | 968 |
Más información
Human CD68 (P34810, 22 a.a. - 319 a.a.) partial-length recombinant protein with His tag at N-Terminus expressed in Escherichia coli.