Idioma:
Español
Español
Português
Español
Português
Buscar
Iniciar sesión
REACTIVOS
INSTRUMENTOS
CONSUMIBLES
OFERTAS
DESTACADOS
FABRICANTES
PUBLICACIONES CIENTÍFICAS
DESCARGAS
NEWSLETTERS
BIOGEN Científica
Reactivos
ABNOVA
Protein
CD40 (Human) Recombinant Protein
Abnova
CD40 (Human) Recombinant Protein
Ref: AB-P9085
CD40 (Human) Recombinant Protein
Contáctenos
Información del producto
Human CD40 (P25942, 21 a.a. - 193 a.a.) partial-length recombinant protein with His tag at C-Terminus expressed in HEK293 cell.
Información adicional
Size
20 ug
Gene Name
CD40
Gene Alias
Bp50|CDW40|MGC9013|TNFRSF5|p50
Gene Description
CD40 molecule, TNF receptor superfamily member 5
Storage Conditions
Store at -20C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles.
Application Key
SDS-PAGE
Immunogen Prot. Seq
EPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLRLEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQY
Form
Liquid
Antigen species Target species
Human
Storage Buffer
10% glycerol and Phosphate-Buffered Saline (pH 7.4).
Gene ID
958
Enviar un mensaje
CD40 (Human) Recombinant Protein
Nombre
*
Apellidos
*
Correo electrónico
*
Centro de Investigación
*
Departamento
Teléfono de Contacto
*
Mensaje de consulta sobre el producto
*