Ver mas grande
Pgf (Mouse) Recombinant Protein
AB-P9039
Producto nuevo
Pgf (Mouse) Recombinant Protein
Comprando este producto generará 4 Biopuntos. Su cesta contiene un total 4 Biopuntos puede ser convertido en un Biobonos Descuento 16.00EUR.
Hoja técnica
| Size | 2 x 10 ug |
| Gene Name | Pgf |
| Gene Alias | AI854365|PIGF|Plgf |
| Gene Description | placental growth factor |
| Storage Conditions | Store at -20ºC. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles. |
| Immunogen Prot. Seq | AGNNSTEVEVVPFNEVWGRSYCRPMEKLVYILDEYPDEVSHIFSPSCVLLSRCSGCCGDEGLHCVPIKTANITMQILKIPPNRDPHFYVEMTFSQDVLCECRPILETTKAERRKTKGKRKRSRNSQTEEPHPHHHHHH. |
| Form | Liquid |
| Antigen species Target species | Mouse |
| Storage Buffer | Phosphate Buffered Saline (pH 7.4), 0.1mM PMSF and 10% glycerol. |
| Gene ID | 18654 |
Más información
Mouse Pgf (P49764, 27 a.a. - 158 a.a.) partial-length recombinant protein with His tag at C-Terminus expressed in Baculovirus.