Pgf (Mouse) Recombinant Protein
  • Pgf (Mouse) Recombinant Protein

Pgf (Mouse) Recombinant Protein

Ref: AB-P9039
Pgf (Mouse) Recombinant Protein

Información del producto

Mouse Pgf (P49764, 27 a.a. - 158 a.a.) partial-length recombinant protein with His tag at C-Terminus expressed in Baculovirus.
Información adicional
Size 2 x 10 ug
Gene Name Pgf
Gene Alias AI854365|PIGF|Plgf
Gene Description placental growth factor
Storage Conditions Store at -20C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles.
Application Key SDS-PAGE
Immunogen Prot. Seq AGNNSTEVEVVPFNEVWGRSYCRPMEKLVYILDEYPDEVSHIFSPSCVLLSRCSGCCGDEGLHCVPIKTANITMQILKIPPNRDPHFYVEMTFSQDVLCECRPILETTKAERRKTKGKRKRSRNSQTEEPHPHHHHHH.
Form Liquid
Antigen species Target species Mouse
Storage Buffer Phosphate Buffered Saline (pH 7.4), 0.1mM PMSF and 10% glycerol.
Gene ID 18654

Enviar un mensaje


Pgf (Mouse) Recombinant Protein

Pgf (Mouse) Recombinant Protein