PGF (Human) Recombinant Protein
  • PGF (Human) Recombinant Protein

PGF (Human) Recombinant Protein

Ref: AB-P9037
PGF (Human) Recombinant Protein

Información del producto

Human PGF (P49763, 21 a.a. - 170 a.a.) partial-length recombinant protein with His tag at C-Terminus expressed in HEK293 cell.
Información adicional
Size 2 x 10 ug
Gene Name PGF
Gene Alias D12S1900|PGFL|PLGF|PlGF-2|SHGC-10760
Gene Description placental growth factor
Storage Conditions Store at -20C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles.
Application Key SDS-PAGE
Immunogen Prot. Seq DGSMAVPPQQWALSAGNGSSEVEVVPFQEVWGRSYCRALERLVDVVSEYPSEVEHMFSPSCVSLLRCTGCCGDENLHCVPVETANVTMQLLKIRSGDRPSYVELTFSQHVRCECRPLREKMKPERRRPKGRGKRRREKQRPTDCHLCGDAVPRRHHHHHH
Form Liquid
Antigen species Target species Human
Storage Buffer 10% glycerol and Phosphate-Buffered Saline (pH 7.4).
Gene ID 5228

Enviar un mensaje


PGF (Human) Recombinant Protein

PGF (Human) Recombinant Protein