Ver mas grande
PGF (Human) Recombinant Protein
AB-P9037
Producto nuevo
PGF (Human) Recombinant Protein
Comprando este producto generará 4 Biopuntos. Su cesta contiene un total 4 Biopuntos puede ser convertido en un Biobonos Descuento 16.00EUR.
Hoja técnica
| Size | 2 x 10 ug |
| Gene Name | PGF |
| Gene Alias | D12S1900|PGFL|PLGF|PlGF-2|SHGC-10760 |
| Gene Description | placental growth factor |
| Storage Conditions | Store at -20ºC. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles. |
| Immunogen Prot. Seq | DGSMAVPPQQWALSAGNGSSEVEVVPFQEVWGRSYCRALERLVDVVSEYPSEVEHMFSPSCVSLLRCTGCCGDENLHCVPVETANVTMQLLKIRSGDRPSYVELTFSQHVRCECRPLREKMKPERRRPKGRGKRRREKQRPTDCHLCGDAVPRRHHHHHH |
| Form | Liquid |
| Antigen species Target species | Human |
| Storage Buffer | 10% glycerol and Phosphate-Buffered Saline (pH 7.4). |
| Gene ID | 5228 |
Más información
Human PGF (P49763, 21 a.a. - 170 a.a.) partial-length recombinant protein with His tag at C-Terminus expressed in HEK293 cell.