Idioma:
Español
Español
Português
Español
Português
Buscar
Iniciar sesión
REACTIVOS
INSTRUMENTOS
CONSUMIBLES
OFERTAS
DESTACADOS
FABRICANTES
PUBLICACIONES CIENTÍFICAS
DESCARGAS
NEWSLETTERS
BIOGEN Científica
Reactivos
ABNOVA
Protein
PGF (Human) Recombinant Protein
Abnova
PGF (Human) Recombinant Protein
Ref: AB-P9036
PGF (Human) Recombinant Protein
Contáctenos
Información del producto
Human PGF (P49763) recombinant protein expressed in
Escherichia coli
.
Información adicional
Size
2 x 10 ug
Gene Name
PGF
Gene Alias
D12S1900|PGFL|PLGF|PlGF-2|SHGC-10760
Gene Description
placental growth factor
Storage Conditions
Store at -20C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles.
Application Key
Func,SDS-PAGE
Immunogen Prot. Seq
MLPAVPPQQWALSAGNGSSEVEVVPFQEVWGRSYCRALERLVDVVSEYPSEVEHMFSPSCVSLLRCTGCCGDENLHCVPVETANVTMQLLKIRSGDRPSYVELTFSQHVRCECRPLREKMKPERCGDAVPRR.
Form
Lyophilized
Antigen species Target species
Human
Storage Buffer
Lyophilized from 10mM Sodium Phosphate pH 7.5.
Gene ID
5228
Enviar un mensaje
PGF (Human) Recombinant Protein
Nombre
*
Apellidos
*
Correo electrónico
*
Centro de Investigación
*
Departamento
Teléfono de Contacto
*
Mensaje de consulta sobre el producto
*