Pecam1 (Mouse) Recombinant Protein
  • Pecam1 (Mouse) Recombinant Protein

Pecam1 (Mouse) Recombinant Protein

Ref: AB-P9020
Pecam1 (Mouse) Recombinant Protein

Información del producto

Mouse Pecam1 (Q08481, 18 a.a. - 590 a.a.) partial-length recombinant protein with His tag at C-Terminus expressed in HEK293 cell.
Información adicional
Size 2 x 10 ug
Gene Name Pecam1
Gene Alias C85791|Cd31|MGC102160|PECAM-1|Pecam
Gene Description platelet/endothelial cell adhesion molecule 1
Storage Conditions Store, frozen at -20C for longer periods of time.
For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Avoid multiple freeze-thaw cycles.
Application Key SDS-PAGE
Immunogen Prot. Seq EENSFTINSIHMESLPSWEVMNGQQLTLECLVDISTTSKSRSQHRVLFYKDDAMVYNVTSREHTESYVIPQARVFHSGKYKCTVMLNNKEKTTIEYEVKVHGVSKPKVTLDKKEVTEGGVVTVNCSLQEEKPPIFFKIEKLEVGTKFVKRRIDKTSNENFVLMEFPIEAQDHVLVFRCQAGILSGFKLQESEPIRSEYVTVQESFSTPKFEIKPPGMIIEGDQLHIRCIVQVTHLVQEFTEIIIQKDKAIVATSK
Form Liquid
Antigen species Target species Mouse
Storage Buffer Phosphate Buffered Saline (pH 7.4) and 10% glycerol.
Gene ID 18613

Enviar un mensaje


Pecam1 (Mouse) Recombinant Protein

Pecam1 (Mouse) Recombinant Protein