Ver mas grande
Pecam1 (Mouse) Recombinant Protein
AB-P9020
Producto nuevo
Pecam1 (Mouse) Recombinant Protein
Comprando este producto generará 4 Biopuntos. Su cesta contiene un total 4 Biopuntos puede ser convertido en un Biobonos Descuento 16.00EUR.
Hoja técnica
| Size | 2 x 10 ug |
| Gene Name | Pecam1 |
| Gene Alias | C85791|Cd31|MGC102160|PECAM-1|Pecam |
| Gene Description | platelet/endothelial cell adhesion molecule 1 |
| Storage Conditions | Store, frozen at -20ºC for longer periods of time.<br>For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).<br>Avoid multiple freeze-thaw cycles. |
| Immunogen Prot. Seq | EENSFTINSIHMESLPSWEVMNGQQLTLECLVDISTTSKSRSQHRVLFYKDDAMVYNVTSREHTESYVIPQARVFHSGKYKCTVMLNNKEKTTIEYEVKVHGVSKPKVTLDKKEVTEGGVVTVNCSLQEEKPPIFFKIEKLEVGTKFVKRRIDKTSNENFVLMEFPIEAQDHVLVFRCQAGILSGFKLQESEPIRSEYVTVQESFSTPKFEIKPPGMIIEGDQLHIRCIVQVTHLVQEFTEIIIQKDKAIVATSK |
| Form | Liquid |
| Antigen species Target species | Mouse |
| Storage Buffer | Phosphate Buffered Saline (pH 7.4) and 10% glycerol. |
| Gene ID | 18613 |
Más información
Mouse Pecam1 (Q08481, 18 a.a. - 590 a.a.) partial-length recombinant protein with His tag at C-Terminus expressed in HEK293 cell.