PDGFB (Horse) Recombinant Protein Ver mas grande

PDGFB (Horse) Recombinant Protein

AB-P9014

Producto nuevo

PDGFB (Horse) Recombinant Protein

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 6 Biopuntos. Su cesta contiene un total 6 Biopuntos puede ser convertido en un Biobonos Descuento 24.00EUR.


Hoja técnica

Size 50 ug
Storage Conditions Store, frozen at -20ºC for longer periods of time.<br>For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).<br>Avoid multiple freeze-thaw cycles.
Immunogen Prot. Seq MSLGSLAVAEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQRCSGCCNNRHVQCRPTQVQLRPVQVRKIEIVRKKPTFKKATVTLEDHLACKCETVGAARPVT
Form Lyophilized
Antigen species Target species Horse
Storage Buffer Lyophilized from 10 mM sodium phosphate, pH 7.5.

Más información

Horse PDGFB (XP_005606703) recombinant protein expressed in Escherichia coli.

Consulta sobre un producto

PDGFB (Horse) Recombinant Protein

PDGFB (Horse) Recombinant Protein