PDGFB (Horse) Recombinant Protein
  • PDGFB (Horse) Recombinant Protein

PDGFB (Horse) Recombinant Protein

Ref: AB-P9014
PDGFB (Horse) Recombinant Protein

Información del producto

Horse PDGFB (XP_005606703) recombinant protein expressed in Escherichia coli.
Información adicional
Size 50 ug
Storage Conditions Store, frozen at -20C for longer periods of time.
For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Avoid multiple freeze-thaw cycles.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq MSLGSLAVAEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQRCSGCCNNRHVQCRPTQVQLRPVQVRKIEIVRKKPTFKKATVTLEDHLACKCETVGAARPVT
Form Lyophilized
Antigen species Target species Horse
Storage Buffer Lyophilized from 10 mM sodium phosphate, pH 7.5.

Enviar un mensaje


PDGFB (Horse) Recombinant Protein

PDGFB (Horse) Recombinant Protein