PDGFB (Human) Recombinant Protein
  • PDGFB (Human) Recombinant Protein

PDGFB (Human) Recombinant Protein

Ref: AB-P9009
PDGFB (Human) Recombinant Protein

Información del producto

Human PDGFB (P01127) recombinant protein expressed in Escherichia coli.
Información adicional
Size 2 x 10 ug
Gene Name PDGFB
Gene Alias FLJ12858|PDGF2|SIS|SSV|c-sis
Gene Description platelet-derived growth factor beta polypeptide (simian sarcoma viral (v-sis) oncogene homolog)
Storage Conditions Store at -20C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq SLGSLTIAEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRPTQVQLRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETVAAARPVT.
Form Lyophilized
Antigen species Target species Human
Storage Buffer Lyophilized from PBS, pH7.4.
Gene ID 5155

Enviar un mensaje


PDGFB (Human) Recombinant Protein

PDGFB (Human) Recombinant Protein