OSM (Human) Recombinant Protein
  • OSM (Human) Recombinant Protein

OSM (Human) Recombinant Protein

Ref: AB-P8997
OSM (Human) Recombinant Protein

Información del producto

Human OSM (P13725, 26 a.a. - 234 a.a.) partial-length recombinant protein with His tag at N-Terminus expressed in Escherichia coli.
Información adicional
Size 20 ug
Gene Name OSM
Gene Alias MGC20461
Gene Description oncostatin M
Storage Conditions Store, frozen at -20C for longer periods of time.
For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Avoid multiple freeze-thaw cycles.
Application Key SDS-PAGE
Immunogen Prot. Seq MGSSHHHHHHSSGLVPRGSHMAAIGSCSKEYRVLLGQLQKQTDLMQDTSRLLDPYIRIQGLDVPKLREHCRERPGAFPSEETLRGLGRRGFLQTLNATLGCVLHRLADLEQRLPKAQDLERSGLNIEDLEKLQMARPNILGLRNNIYCMAQLLDNSDTAEPTKAGRGASQPPTPTPASDAFQRKLEGCRFLHGYHRFMHSVGRVFSKWGESPNRSRRHSPHQALRKGVRR.
Form Liquid
Antigen species Target species Human
Storage Buffer 20mM Tris-HCl, pH-8, 1mM DTT and 20% Glycerol.
Gene ID 5008

Enviar un mensaje


OSM (Human) Recombinant Protein

OSM (Human) Recombinant Protein