TNFRSF11B (Human) Recombinant Protein
  • TNFRSF11B (Human) Recombinant Protein

TNFRSF11B (Human) Recombinant Protein

Ref: AB-P8991
TNFRSF11B (Human) Recombinant Protein

Información del producto

Human TNFRSF11B (O00300, 22 a.a. - 401 a.a.) partial-length recombinant protein with His tag at C-Terminus expressed in Baculovirus.
Información adicional
Size 2 x 10 ug
Gene Name TNFRSF11B
Gene Alias MGC29565|OCIF|OPG|TR1
Gene Description tumor necrosis factor receptor superfamily, member 11b
Storage Conditions Store at -20C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles.
Application Key SDS-PAGE
Immunogen Prot. Seq ADPETFPPKYLHYDEETSHQLLCDKCPPGTYLKQHCTAKWKTVCAPCPDHYYTDSWHTSDECLYCSPVCKELQYVKQECNRTHNRVCECKEGRYLEIEFCLKHRSCPPGFGVVQAGTPERNTVCKRCPDGFFSNETSSKAPCRKHTNCSVFGLLLTQKGNATHDNICSGNSESTQKCGIDVTLCEEAFFRFAVPTKFTPNWLSVLVDNLPGTKVNAESVERIKRQHSSQEQTFQLLKLWKHQNKDQDIVKKIIQD
Form Liquid
Antigen species Target species Human
Storage Buffer PBS pH-7.4 and 10% glycerol.
Gene ID 4982

Enviar un mensaje


TNFRSF11B (Human) Recombinant Protein

TNFRSF11B (Human) Recombinant Protein