Ver mas grande
ITLN1 (Human) Recombinant Protein
AB-P8986
Producto nuevo
ITLN1 (Human) Recombinant Protein
Comprando este producto generará 4 Biopuntos. Su cesta contiene un total 4 Biopuntos puede ser convertido en un Biobonos Descuento 16.00EUR.
Hoja técnica
| Size | 2 x 10 ug |
| Gene Name | ITLN1 |
| Gene Alias | FLJ20022|HL-1|HL1|INTL|ITLN|LFR|hIntL|omentin |
| Gene Description | intelectin 1 (galactofuranose binding) |
| Storage Conditions | Store, frozen at -20ºC for longer periods of time.<br>For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).<br>Avoid multiple freeze-thaw cycles. |
| Immunogen Prot. Seq | MRGSHHHHHHGMASTDEANTYFKEWTCSSSPSLPRSCKEIKDECPSAFDGLYFLRTENGVIYQTFCDMTSGGGGWTLVASVHENDMRGKCTVGDRWSSQQGSKAVYPEGDGNWANYNTFGSAEAATSDDYKNPGYYDIQAKDLGIWHVPNKSPMQHWRNSSLLRYRTDTGFLQTLGHNLFGIYQKYPVKYGEGKCWTDNGPVIPVVYDFGDAQKTASYYSPYGQREFTAGFVQFRVFNNERAANALCAGMRVTGC |
| Form | Lyophilized |
| Antigen species Target species | Human |
| Storage Buffer | 20mM Tris & 50mM NaCl pH-8.0. |
| Gene ID | 55600 |
Más información
Human ITLN1 (Q8WWA0) recombinant protein with His tag at N-Terminus expressed in Escherichia coli.