Nog (Mouse) Recombinant Protein
  • Nog (Mouse) Recombinant Protein

Nog (Mouse) Recombinant Protein

Ref: AB-P8976
Nog (Mouse) Recombinant Protein

Información del producto

Mouse Nog (P97466) recombinant protein expressed in Escherichia coli.
Información adicional
Size 20 ug
Gene Name Nog
Gene Alias -
Gene Description noggin
Storage Conditions Store, frozen at -20C for longer periods of time.
For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Avoid multiple freeze-thaw cycles.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq MQHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYDPGFMATSPPEDRPGGGGGPAGGAEDLAELDQLLRQRPSGAMPSEIKGLEFSEGLAQGKKQRLSKKLRRKLQMWLWSQTFCPVLYAWNDLGSRFWPRYVKVGSCFSKRSCSVPEGMVCKPSKSVHLTVLRWRCQRRGQRCGWIPIQYPIISECKCSC.
Form Lyophilized
Antigen species Target species Mouse
Storage Buffer Lyophilized from 30% acetonitrile, 0.1% TFA.
Gene ID 18121

Enviar un mensaje


Nog (Mouse) Recombinant Protein

Nog (Mouse) Recombinant Protein