Ver mas grande
Il19 (Mouse) Recombinant protein
AB-P8791
Producto nuevo
Il19 (Mouse) Recombinant protein
Comprando este producto generará 4 Biopuntos. Su cesta contiene un total 4 Biopuntos puede ser convertido en un Biobonos Descuento 16.00EUR.
Hoja técnica
| Size | 2 x 10 ug |
| Gene Name | Il19 |
| Gene Alias | - |
| Gene Description | interleukin 19 |
| Storage Conditions | Lyophilized although stable at room temperature for 3 weeks. should be stored desiccated below -20ºC. Upon reconstitution should be stored at 4ºC between 2-7 days and for future use below -20ºC. For long term storage it is recommended to add a carrier pro |
| Immunogen Prot. Seq | MLRRCLISVDMRLIEKSFHEIKRAMQTKDTFKNVTILSLENLRSIKPGDVCCMTNNLL TFYRDRVFQDHQERSLEVLRRISSIANSFLCVQKSLERCQVHRQCNCSQEATNATRIIHDNYNQLEVSSAALKSLGELNILLAWIDRNHLETPAA. |
| Form | Lyophilized |
| Antigen species Target species | Mouse |
| Storage Buffer | Lyophilized from 5mM Na3PO4 and 150mM NaCl, pH 7.5 |
| Gene ID | 329244 |
Más información
Mouse Il19 (Q8CJ70) recombinant protein expressed in Escherichia Coli.