Ver mas grande
HGF (Human) Recombinant Protein
AB-P8759
Producto nuevo
HGF (Human) Recombinant Protein
Comprando este producto generará 4 Biopuntos. Su cesta contiene un total 4 Biopuntos puede ser convertido en un Biobonos Descuento 16.00EUR.
Hoja técnica
| Size | 2 x 10 ug |
| Gene Name | HGF |
| Gene Alias | F-TCF|HGFB|HPTA|SF |
| Gene Description | hepatocyte growth factor (hepapoietin A |
| Storage Conditions | Lyophilized protein at room temperature for 3 weeks, should be stored at -20ºC. Protein aliquots at 4ºC for 2-7 days and should be stored at -20ºC to -80ºC. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). <br>Avoid repe |
| Immunogen Prot. Seq | QRKRRNTIHEFKKSAKTTLIKIDPALKIKTKKVNTADQCANRCTRNKGLPFTCKAFVFDKARKQCLWFPFNSMSSGVKKEFGHEFDLYENKDYIRNCIIGKGRSYKGTVSITKSGIKCQPWSSMIPHEHSYRGKDLQENYCRNPRGEEGGPWCFTSNPEVRYEVCDIPQCSEVECMTCNGESYRGLMDHTESGKICQRWDHQTPHRHKFLPERYPDKGFDDNYCRNPDGQPRPWCYTLDPHTRWEYCAIKTCADN |
| Form | Lyophilized |
| Antigen species Target species | Human |
| Storage Buffer | Protein (1 mg/mL) was lyophilized from a solution containing 50 mM acetic acid. Reconstitute the lyophilized powder in 50 mM acetic acid to 100 ug/mL. |
| Gene ID | 3082 |
Más información
Human HGF recombinant protein expressed in Insect cells.