HGF (Human) Recombinant Protein
  • HGF (Human) Recombinant Protein

HGF (Human) Recombinant Protein

Ref: AB-P8759
HGF (Human) Recombinant Protein

Información del producto

Human HGF recombinant protein expressed in Insect cells.
Información adicional
Size 2 x 10 ug
Gene Name HGF
Gene Alias F-TCF|HGFB|HPTA|SF
Gene Description hepatocyte growth factor (hepapoietin A
Storage Conditions Lyophilized protein at room temperature for 3 weeks, should be stored at -20C. Protein aliquots at 4C for 2-7 days and should be stored at -20C to -80C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Avoid repeated
Application Key Func
Immunogen Prot. Seq QRKRRNTIHEFKKSAKTTLIKIDPALKIKTKKVNTADQCANRCTRNKGLPFTCKAFVFDKARKQCLWFPFNSMSSGVKKEFGHEFDLYENKDYIRNCIIGKGRSYKGTVSITKSGIKCQPWSSMIPHEHSYRGKDLQENYCRNPRGEEGGPWCFTSNPEVRYEVCDIPQCSEVECMTCNGESYRGLMDHTESGKICQRWDHQTPHRHKFLPERYPDKGFDDNYCRNPDGQPRPWCYTLDPHTRWEYCAIKTCADN
Form Lyophilized
Antigen species Target species Human
Storage Buffer Protein (1 mg/mL) was lyophilized from a solution containing 50 mM acetic acid. Reconstitute the lyophilized powder in 50 mM acetic acid to 100 ug/mL.
Gene ID 3082

Enviar un mensaje


HGF (Human) Recombinant Protein

HGF (Human) Recombinant Protein