Gmfb (Mouse) Recombinant Protein Ver mas grande

Gmfb (Mouse) Recombinant Protein

AB-P8752

Producto nuevo

Gmfb (Mouse) Recombinant Protein

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 4 Biopuntos. Su cesta contiene un total 4 Biopuntos puede ser convertido en un Biobonos Descuento 16.00EUR.


Hoja técnica

Size 2 x 10 ug
Gene Name Gmfb
Gene Alias 3110001H22Rik|3110001O16Rik|AI851627|C79176|D14Ertd630e
Gene Description glia maturation factor, beta
Storage Conditions Lyophilized protein at room temperature for 3 weeks, should be stored at -20ºC. Protein aliquots at 4ºC for 2-7 days and should be stored at -20ºC to -80ºC. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). <br>Avoid repe
Immunogen Prot. Seq SESLVVCDVAEDLVEKLRKFRFRKETHNAAIIMKIDKDERLVVLDEELEGVSPDELKDELPERQPRFIVYSYKYQHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKNKLVQTAELTKVFEIRNTEDLTEEWLREKLGFFH
Form Lyophilized
Antigen species Target species Mouse
Storage Buffer Lyophilized from a solution containing 1X PBS, pH7.4. Reconstitute the lyophilized powder in ddH<sub>2</sub>O to 100 ug/mL.
Gene ID 63985

Más información

Mouse Gmfb recombinant protein expressed in Escherichia coli.

Consulta sobre un producto

Gmfb (Mouse) Recombinant Protein

Gmfb (Mouse) Recombinant Protein