Csf2 (Porcine) Recombinant Protein
  • Csf2 (Porcine) Recombinant Protein

Csf2 (Porcine) Recombinant Protein

Ref: AB-P8748
Csf2 (Porcine) Recombinant Protein

Información del producto

Porcine Csf2 recombinant protein expressed in?Escherichia coli.
Información adicional
Size 100 ug
Gene Name Csf2
Gene Alias Gm-csf|Gmcsf
Gene Description colony stimulating factor 2 (granulocyte-macrophage)
Storage Conditions Lyophilized protein at room temperature for 3 weeks, should be stored at -20C. Protein aliquots at 4C for 2-7 days and should be stored at -20C to -80C.
Avoid repeated freeze/thaw cycles.
Application Key Func
Immunogen Prot. Seq MAPTRPPSPVTRPWQHVDAIKEALSLLNNSNDTAAVMNETVDVVCEMFDPQEPTCVQTRLNLYKQGLRGSLTRLKSPLTLLAKHYEQHCPLTEETSCETQSITFKSFKDSLNKFLFTIPFDCWGPVKK
Form Lyophilized
Antigen species Target species Pig
Storage Buffer Protein (1 mg/mL) was lyophilized from a solution containing 10 mM sodium phosphate buffer, pH 7.5. Reconstitute the lyophilized powder in ddH2O to 100 ug/mL.
Gene ID 116630

Enviar un mensaje


Csf2 (Porcine) Recombinant Protein

Csf2 (Porcine) Recombinant Protein