Ghr (Rat) Recombinant Protein
  • Ghr (Rat) Recombinant Protein

Ghr (Rat) Recombinant Protein

Ref: AB-P8739
Ghr (Rat) Recombinant Protein

Información del producto

Rat Ghr partial recombinant protein expressed in Baculovirus.
Información adicional
Size 2 x 10 ug
Gene Name Ghr
Gene Alias GHR/BP|MGC124963|MGC156665
Gene Description growth hormone receptor
Storage Conditions Store at 4C for 2-4 weeks and should be stored at -20C to -80C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Avoid repeated freeze/thaw cycles.
Application Key SDS-PAGE
Immunogen Prot. Seq FPGSGATPATLGKASPVLQRINPSLRESSSGKPRFTKCRSPELETFSCYWTEGDDHNLKVPGSIQLYYARRIAHEWTPEWKECPDYVSAGANSCYFNSSYTSIWIPYCIKLTTNGDLLKEKCFTVDEIVQPDPPIGLNWTLLNISLPGIRGDIQVSWQPPPSADVLKGWIILEYEIQYKEVNETKWKTMSPIWSTSVPLYSLRLDKEHEVRVRSRQRSFEKYSEFSEVLRVTFPQMDTLAACEEDFRLEHHHHHH
Form Liquid
Antigen species Target species Rat
Storage Buffer solution (0.5 mg/mL) containing 1X PBS, pH 7.4,10% glycerol.
Gene ID 25235

Enviar un mensaje


Ghr (Rat) Recombinant Protein

Ghr (Rat) Recombinant Protein