Ver mas grande
gh1 (Zebrafish) Recombinant Protein
AB-P8729
Producto nuevo
gh1 (Zebrafish) Recombinant Protein
Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.
Hoja técnica
| Size | 50 ug |
| Gene Name | gh1 |
| Gene Alias | ghl |
| Gene Description | growth hormone 1 |
| Storage Conditions | Lyophilized protein at room temperature for 2 weeks, should be stored at -20ºC. Protein aliquots at 4ºC, pH 9 for 4 weeks and should be stored at -20ºC to -80ºC. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). <br>Avoid |
| Immunogen Prot. Seq | AQRLFNNAVIRVQHLHQLAAKMINDFEEGLMPEERRQLSKIFPLSFCNSDSIETPTGKDETQKSSMLKLLRISFRLIESWEFPSQTLSSTISNSLTIGNPNLITEKLVDLKMGISVLIKGCLDGQPNMDDNDSLPLPFEDFYLTVGETSLRESFRLLACFKKDMHKVETYLRVANCRRSLDSNCTL |
| Form | Lyophilized |
| Storage Buffer | Protein (1 mg/mL) was lyophilized from a solution containing 0.5% NaHCO<sub>3</sub>, pH 8. Reconstitute the lyophilized powder in 0.4% NaHCO<sub>3</sub> or ddH<sub>2</sub>O to 100 ug/mL, pH 9.0. |
| Gene ID | 407639 |
Más información
Zebrafish gh1 recombinant protein with Ala tag in N-terminus expressed in?Escherichia coli.