gh1 (Zebrafish) Recombinant Protein Ver mas grande

gh1 (Zebrafish) Recombinant Protein

AB-P8729

Producto nuevo

gh1 (Zebrafish) Recombinant Protein

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.


Hoja técnica

Size 50 ug
Gene Name gh1
Gene Alias ghl
Gene Description growth hormone 1
Storage Conditions Lyophilized protein at room temperature for 2 weeks, should be stored at -20ºC. Protein aliquots at 4ºC, pH 9 for 4 weeks and should be stored at -20ºC to -80ºC. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). <br>Avoid
Immunogen Prot. Seq AQRLFNNAVIRVQHLHQLAAKMINDFEEGLMPEERRQLSKIFPLSFCNSDSIETPTGKDETQKSSMLKLLRISFRLIESWEFPSQTLSSTISNSLTIGNPNLITEKLVDLKMGISVLIKGCLDGQPNMDDNDSLPLPFEDFYLTVGETSLRESFRLLACFKKDMHKVETYLRVANCRRSLDSNCTL
Form Lyophilized
Storage Buffer Protein (1 mg/mL) was lyophilized from a solution containing 0.5% NaHCO<sub>3</sub>, pH 8. Reconstitute the lyophilized powder in 0.4% NaHCO<sub>3</sub> or ddH<sub>2</sub>O to 100 ug/mL, pH 9.0.
Gene ID 407639

Más información

Zebrafish gh1 recombinant protein with Ala tag in N-terminus expressed in?Escherichia coli.

Consulta sobre un producto

gh1 (Zebrafish) Recombinant Protein

gh1 (Zebrafish) Recombinant Protein