Csf3 (Mouse) Recombinant Protein Ver mas grande

Csf3 (Mouse) Recombinant Protein

AB-P8708

Producto nuevo

Csf3 (Mouse) Recombinant Protein

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 4 Biopuntos. Su cesta contiene un total 4 Biopuntos puede ser convertido en un Biobonos Descuento 16.00EUR.


Hoja técnica

Size 2 x 10 ug
Gene Name Csf3
Gene Alias Csfg|G-CSF|MGI-IG
Gene Description colony stimulating factor 3 (granulocyte)
Storage Conditions Lyophilized protein at room temperature for 3 weeks, should be stored at -20ºC. Protein aliquots at 4ºC for 2-7 days and should be stored at -20ºC to -80ºC. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). <br>Avoid repe
Immunogen Prot. Seq VPLVTVSALPPSLPLPRSFLLKSLEQVRKIQASGSVLLEQLCATYKLCHPEELVLLGHSLGIPKASLSGCSSQALQQTQCLSQLHSGLCLYQGLLQALSGISPALAPTLDLLQLDVANFATTIWQQMENLGVAPTVQPTQSAMPAFTSAFQRRAGGVLAISYLQGFLETARLALHHLA
Form Lyophilized
Antigen species Target species Mouse
Storage Buffer Lyophilized from a solution containing 10 mM NaCitrate, pH 4.0, 150 mM NaCl. Reconstitute the lyophilized powder in ddH<sub>2</sub>O to 100 ug/mL.
Gene ID 12985

Más información

Mouse Csf3 recombinant protein expressed in Escherichia coli.

Consulta sobre un producto

Csf3 (Mouse) Recombinant Protein

Csf3 (Mouse) Recombinant Protein