Csf3 (Mouse) Recombinant Protein
  • Csf3 (Mouse) Recombinant Protein

Csf3 (Mouse) Recombinant Protein

Ref: AB-P8708
Csf3 (Mouse) Recombinant Protein

Información del producto

Mouse Csf3 recombinant protein expressed in Escherichia coli.
Información adicional
Size 2 x 10 ug
Gene Name Csf3
Gene Alias Csfg|G-CSF|MGI-IG
Gene Description colony stimulating factor 3 (granulocyte)
Storage Conditions Lyophilized protein at room temperature for 3 weeks, should be stored at -20C. Protein aliquots at 4C for 2-7 days and should be stored at -20C to -80C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Avoid repeated
Application Key Func
Immunogen Prot. Seq VPLVTVSALPPSLPLPRSFLLKSLEQVRKIQASGSVLLEQLCATYKLCHPEELVLLGHSLGIPKASLSGCSSQALQQTQCLSQLHSGLCLYQGLLQALSGISPALAPTLDLLQLDVANFATTIWQQMENLGVAPTVQPTQSAMPAFTSAFQRRAGGVLAISYLQGFLETARLALHHLA
Form Lyophilized
Antigen species Target species Mouse
Storage Buffer Lyophilized from a solution containing 10 mM NaCitrate, pH 4.0, 150 mM NaCl. Reconstitute the lyophilized powder in ddH2O to 100 ug/mL.
Gene ID 12985

Enviar un mensaje


Csf3 (Mouse) Recombinant Protein

Csf3 (Mouse) Recombinant Protein