Ver mas grande
CSF3 (Human) Recombinant Protein
AB-P8705
Producto nuevo
CSF3 (Human) Recombinant Protein
Comprando este producto generará 4 Biopuntos. Su cesta contiene un total 4 Biopuntos puede ser convertido en un Biobonos Descuento 16.00EUR.
Hoja técnica
| Size | 2 x 10 ug |
| Gene Name | CSF3 |
| Gene Alias | G-CSF|GCSF|MGC45931 |
| Gene Description | colony stimulating factor 3 (granulocyte) |
| Storage Conditions | Lyophilized protein at room temperature for 3 weeks, should be stored at -20ºC. Protein aliquots at 4ºC for 2-7 days and should be stored at -20ºC to -80ºC. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). <br>Avoid repe |
| Immunogen Prot. Seq | TPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLCATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRVLRHLAQP |
| Form | Lyophilized |
| Antigen species Target species | Human |
| Storage Buffer | Protein (1 mg/mL) was lyophilized from a solution containing 10 mM Hydrochloric Acid, pH=6.5, 0.4 mg TWEEN-20, 100 mg mannitol, 160 mg L-arginine, 40 mg phenylalanine and 4 mg methionine. Reconstitute the lyophilized powder in ddH<sub>2</sub>O to 100 ug/m |
| Gene ID | 1440 |
Más información
Human CSF3 recombinant protein expressed in CHO cells.