GDF10 (Human) Recombinant Protein
  • GDF10 (Human) Recombinant Protein

GDF10 (Human) Recombinant Protein

Ref: AB-P8696
GDF10 (Human) Recombinant Protein

Información del producto

Human GDF10 partial recombinant protein expressed in Escherichia coli.
Información adicional
Size 20 ug
Gene Name GDF10
Gene Alias BMP-3b|BMP3B
Gene Description growth differentiation factor 10
Storage Conditions Store at 4C for 2-4 weeks and should be stored at -20C to -80C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Avoid repeated freeze/thaw cycles.
Application Key SDS-PAGE
Immunogen Prot. Seq MQWDEPRVCSRRYLKVDFADIGWNEWIISPKSFDAYYCAGACEFPMPKIVRPSNHATIQSIVRAVGIIPGIPEPCCVPDKMNSLGVLFLDENRNVVLKVYPNMSVDTCACR
Form Liquid
Antigen species Target species Human
Storage Buffer Solution (1 mg/mL) containing��10mM Sodium citrate, pH 3.5, 40% glycerol, 1 mM DTT, 0.1M NaCl.
Gene ID 2662

Enviar un mensaje


GDF10 (Human) Recombinant Protein

GDF10 (Human) Recombinant Protein