Ver mas grande
GDF5 (Human) Recombinant Protein
AB-P8691
Producto nuevo
GDF5 (Human) Recombinant Protein
Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.
Hoja técnica
| Size | 25 ug |
| Gene Name | GDF5 |
| Gene Alias | BMP14|CDMP1|LAP4|SYNS2 |
| Gene Description | growth differentiation factor 5 |
| Storage Conditions | Store at 4ºC for 2-4 weeks and should be stored at -20ºC to -80ºC. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). <br>Avoid repeated freeze/thaw cycles. |
| Immunogen Prot. Seq | MGSSHHHHHHSSGLVPRGSHMAPLATRQGKRPSKNLKARCSRKALHVNFKDMGWDDWIIAPLEYEAFHCEGLCEFPLRSHLEPTNHAVIQTLMNSMDPESTPPTCCVPTRLSPISILFIDSANNVVYKQYEDMVVESCGCR |
| Form | Liquid |
| Antigen species Target species | Human |
| Storage Buffer | Solution containing 10mM sodium citrate, pH 3.5, 10% glycerol. |
| Gene ID | 8200 |
Más información
Human GDF5 partial recombinant protein with His tag in N-terminus expressed in Escherichia coli.