Ver mas grande
Gdnf (Mouse) Recombinant Protein
AB-P8683
Producto nuevo
Gdnf (Mouse) Recombinant Protein
Comprando este producto generará 4 Biopuntos. Su cesta contiene un total 4 Biopuntos puede ser convertido en un Biobonos Descuento 16.00EUR.
Hoja técnica
| Size | 2 x 10 ug |
| Gene Name | Gdnf |
| Gene Alias | AI385739 |
| Gene Description | glial cell line derived neurotrophic factor |
| Storage Conditions | Lyophilized protein at room temperature for 3 weeks, should be stored at -20ºC. Protein aliquots at 4ºC for 2-7 days and should be stored at -20ºC to -80ºC. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). <br>Avoid repe |
| Immunogen Prot. Seq | MSPDKQAALPRRENRNRQAAAASPENSRGKGRRGQRGKNRGCVLTAIHLNVTDLGLGYETKEELIFRYCSGSCESAETMYDKILKNLSRSRRLTSDKVGQACCRPVAFDDDLSFLDDNLVYHILRKHSAKRCGCI |
| Form | Lyophilized |
| Antigen species Target species | Mouse |
| Storage Buffer | The protein was lyophilized with no additives. Reconstitute the lyophilized powder in ddH<sub>2</sub>O to 100 ug/mL. |
| Gene ID | 14573 |
Más información
Mouse Gdnf recombinant protein expressed in Escherichia coli.