GDNF (Human) Recombinant Protein Ver mas grande

GDNF (Human) Recombinant Protein

AB-P8682

Producto nuevo

GDNF (Human) Recombinant Protein

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 4 Biopuntos. Su cesta contiene un total 4 Biopuntos puede ser convertido en un Biobonos Descuento 16.00EUR.


Hoja técnica

Size 2 x 10 ug
Gene Name GH1
Gene Alias GH|GH-N|GHN|hGH-N
Gene Description growth hormone 1
Storage Conditions Store at 4ºC for 2-4 weeks and should be stored at -20ºC to -80ºC. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). <br>Avoid repeated freeze/thaw cycles.
Immunogen Prot. Seq ADPMRGQRGKNRGCVLTAIHLNVTDLGLGYETKEELIFRYCSGSCDAAETTYDKILKNLSRNRRLVSDKVGQACCRPIAFDDDLSFLDDNLVYHILRKHSAKRCGCIHHHHHH
Form Liquid
Antigen species Target species Human
Storage Buffer Solution (0.25 mg/mL) containing 1X PBS, pH 7.4, 10% glycerol.
Gene ID 2688

Más información

Human GDNF partial recombinant protein with His tag in N-terminus expressed in Baculovirus.

Consulta sobre un producto

GDNF (Human) Recombinant Protein

GDNF (Human) Recombinant Protein