Ver mas grande
LGALS13 (Human) Recombinant Protein
AB-P8678
Producto nuevo
LGALS13 (Human) Recombinant Protein
Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.
Hoja técnica
| Size | 100 ug |
| Gene Name | LGALS13 |
| Gene Alias | GAL13|PLAC8|PP13 |
| Gene Description | lectin, galactoside-binding, soluble, 13 |
| Storage Conditions | Store at 4ºC for 2-4 weeks and should be stored at -20ºC to -80ºC. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). <br>Avoid repeated freeze/thaw cycles. |
| Immunogen Prot. Seq | MSSLPVPYKLPVSLSVGSCVIIKGTPIHSFINDPQLQVDFYTDMDEDSDIAFRFRVHFGNHVVMNRREFGIWMLEETTDYVPFEDGKQFELCIYVHYNEYEIKVNGIRIYGFVHRIPPSFVKMVQVSRDISLTSVCVCN |
| Form | Liquid |
| Antigen species Target species | Human |
| Storage Buffer | Solution (0.5 mg/mL) in 1X PBS, pH 7.4. |
| Gene ID | 29124 |
Más información
Human LGALS13 recombinant protein with His tag in N-terminus expressed in Escherichia coli.