AB-P8678
Producto nuevo
Este producto ya no esta disponible
Fecha disponibilidad
Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.
Size | 100 ug |
Gene Name | LGALS13 |
Gene Alias | GAL13|PLAC8|PP13 |
Gene Description | lectin, galactoside-binding, soluble, 13 |
Storage Conditions | Store at 4ºC for 2-4 weeks and should be stored at -20ºC to -80ºC. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). <br>Avoid repeated freeze/thaw cycles. |
Immunogen Prot. Seq | MSSLPVPYKLPVSLSVGSCVIIKGTPIHSFINDPQLQVDFYTDMDEDSDIAFRFRVHFGNHVVMNRREFGIWMLEETTDYVPFEDGKQFELCIYVHYNEYEIKVNGIRIYGFVHRIPPSFVKMVQVSRDISLTSVCVCN |
Form | Liquid |
Antigen species Target species | Human |
Storage Buffer | Solution (0.5 mg/mL) in 1X PBS, pH 7.4. |
Gene ID | 29124 |