Idioma:
Español
Español
Português
Español
Português
Buscar
Iniciar sesión
REACTIVOS
INSTRUMENTOS
CONSUMIBLES
OFERTAS
DESTACADOS
FABRICANTES
PUBLICACIONES CIENTÍFICAS
DESCARGAS
NEWSLETTERS
BIOGEN Científica
Reactivos
ABNOVA
Protein
LGALS3 (Human) Recombinant Protein
Abnova
LGALS3 (Human) Recombinant Protein
Ref: AB-P8665
LGALS3 (Human) Recombinant Protein
Contáctenos
Información del producto
Human LGALS3 full-length recombinant protein with His tag in N-terminus expressed in
Escherichia coli
.
Información adicional
Size
25 ug
Gene Name
LGALS3
Gene Alias
CBP35|GAL3|GALBP|GALIG|LGALS2|MAC2
Gene Description
lectin, galactoside-binding, soluble, 3
Storage Conditions
Store at 4C for 2-4 weeks and should be stored at -20C to -80C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Avoid repeated freeze/thaw cycles.
Application Key
Func
Immunogen Prot. Seq
MGSSHHHHHHSSGLVPRGSHMADNFSLHDALSGSGNPNPQGWPGAWGNQPAGAGGYPGASYPGAYPGQAPPGAYPGQAPPGAYPGAPGAYPGAPAPGVYPGPPSGPGAYPSSGQPSATGAYPATGPYGAPAGPLIVPYNLPLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFNPRFNENNRRVIVCNTKLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISKLG
Form
Liquid
Antigen species Target species
Human
Storage Buffer
Solution (0.5 mg/mL) containing 20 mM Tris-HCl, pH 8.0, 10% glycerol, 0.1 M NaCl, 1 mM DTT.
Gene ID
3958
Enviar un mensaje
LGALS3 (Human) Recombinant Protein
Nombre
*
Apellidos
*
Correo electrónico
*
Centro de Investigación
*
Departamento
Teléfono de Contacto
*
Mensaje de consulta sobre el producto
*