Hbegf (Rat) Recombinant Protein
  • Hbegf (Rat) Recombinant Protein

Hbegf (Rat) Recombinant Protein

Ref: AB-P8657
Hbegf (Rat) Recombinant Protein

Información del producto

Rat Hbegf recombinant protein expressed in Escherichia coli.
Información adicional
Size 50 ug
Gene Name Hbegf
Gene Alias Dtr|GFHB|Hb-egf|Hegfl
Gene Description heparin-binding EGF-like growth factor
Storage Conditions Lyophilized protein at room temperature for 3 weeks, should be stored at -20C. Protein aliquots at 4C for 2-7 days and should be stored at -20C to -80C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Avoid repeated
Application Key Func
Immunogen Prot. Seq DLEGTDLDLFKVAFSSKPQALATPGKEKNGKKKRKGKGLGKKRDPCLKKYKDYCIHGECRYLKELRIPSCHCLPGYHGQRCHGLTL
Form Lyophilized
Antigen species Target species Rat
Storage Buffer Lyophilized from a solution containing 1X PBS, pH 7.4, 300 mM NaCl, 5% trehalose. Reconstitute the lyophilized powder in ddH2O to 100 ug/mL.
Gene ID 25433

Enviar un mensaje


Hbegf (Rat) Recombinant Protein

Hbegf (Rat) Recombinant Protein