Ver mas grande
Hbegf (Rat) Recombinant Protein
AB-P8657
Producto nuevo
Hbegf (Rat) Recombinant Protein
Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.
Hoja técnica
| Size | 50 ug |
| Gene Name | Hbegf |
| Gene Alias | Dtr|GFHB|Hb-egf|Hegfl |
| Gene Description | heparin-binding EGF-like growth factor |
| Storage Conditions | Lyophilized protein at room temperature for 3 weeks, should be stored at -20ºC. Protein aliquots at 4ºC for 2-7 days and should be stored at -20ºC to -80ºC. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). <br>Avoid repe |
| Immunogen Prot. Seq | DLEGTDLDLFKVAFSSKPQALATPGKEKNGKKKRKGKGLGKKRDPCLKKYKDYCIHGECRYLKELRIPSCHCLPGYHGQRCHGLTL |
| Form | Lyophilized |
| Antigen species Target species | Rat |
| Storage Buffer | Lyophilized from a solution containing 1X PBS, pH 7.4, 300 mM NaCl, 5% trehalose. Reconstitute the lyophilized powder in ddH<sub>2</sub>O to 100 ug/mL. |
| Gene ID | 25433 |
Más información
Rat Hbegf recombinant protein expressed in Escherichia coli.