FST (Human) Recombinant Protein
  • FST (Human) Recombinant Protein

FST (Human) Recombinant Protein

Ref: AB-P8650
FST (Human) Recombinant Protein

Información del producto

Human FST recombinant protein with His tag in N-terminus expressed in Escherichia coli.
Información adicional
Size 2 x 10 ug
Gene Name FST
Gene Alias FS
Gene Description follistatin
Storage Conditions Lyophilized protein should be stored at -20C. Protein aliquots at 4C for 2 weeks.
Avoid repeated freeze/thaw cycles.
Application Key SDS-PAGE
Immunogen Prot. Seq MKHHHHHHASGNCWLRQAKNGRCQVLYKTELSKEECCSTGRLSTSWTEEDVNDNTLFKWMIFNGGAPNCIPCKETCENVDCGPGKKCRMNKKNKPRCVCAPDCSNITWKGPVCGLDGKTYRNECALLKARCKEQPELEVQYQGRCKKTCRDVFCPGSSTCVVDQTNNAYCVTCNRICPEPASSEQYLCGNDGVTYSSACHLRKATCLLGRSIGLAYEGKCIKAKSCEDIQCTGGKKCLWDFKVGRGRCSLCDELC
Form Lyophilized
Antigen species Target species Human
Storage Buffer Protein (0.5 mg/mL) was lyophilized from a solution containing 20 mM Tris, pH 7.5, 20 mM NaCl. Reconstitute the lyophilized powder in ddH2O to 0.5mg/mL, and is not sterile! Please filter the product by an sterile filter before use.
Gene ID 10468

Enviar un mensaje


FST (Human) Recombinant Protein

FST (Human) Recombinant Protein