Ver mas grande
FIBP (Human) Recombinant Protein
AB-P8641
Producto nuevo
FIBP (Human) Recombinant Protein
Comprando este producto generará 4 Biopuntos. Su cesta contiene un total 4 Biopuntos puede ser convertido en un Biobonos Descuento 16.00EUR.
Hoja técnica
| Size | 2 x 10 ug |
| Gene Name | FIBP |
| Gene Alias | FGFIBP|FIBP-1 |
| Gene Description | fibroblast growth factor (acidic) intracellular binding protein |
| Storage Conditions | Store at 4ºC for 2-4 weeks and should be stored at -20ºC to -80ºC. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). <br>Avoid repeated freeze/thaw cycles. |
| Immunogen Prot. Seq | MGSSHHHHHHSSGLVPRGSHMGSMTSELDIFVGNTTLIDEDVYRLWLDGYSVTDAVALRVRSGILEQTGATAAVLQSDTMDHYRTFHMLERLLHAPPKLLHQLIFQIPPSRQALLIERYYAFDEAFVREVLGKKLSKGTKKDLDDISTKTGITLKSCRRQFDNFKRVFKVVEEMRGSLVDNIQQHFLLSDRLARDYAAIVFFANNRFETGKKKLQYLSFGDFAFCAELMIQNWTLGAVGEAPTDPDSQMDDMDMD |
| Form | Liquid |
| Antigen species Target species | Human |
| Storage Buffer | Solution (0.5 mg/mL) containing��20 mM Tris-HCl, pH 8.0, 10% glycerol. |
| Gene ID | 9158 |
Más información
Human FIBP full-length recombinant protein with His tag in N-terminus expressed in Escherichia coli.