Idioma:
Español
Español
Português
Español
Português
Buscar
Iniciar sesión
REACTIVOS
INSTRUMENTOS
CONSUMIBLES
OFERTAS
DESTACADOS
FABRICANTES
PUBLICACIONES CIENTÍFICAS
DESCARGAS
NEWSLETTERS
BIOGEN Científica
Reactivos
ABNOVA
Protein
FGF23 (Human) Recombinant Protein
Abnova
FGF23 (Human) Recombinant Protein
Ref: AB-P8638
FGF23 (Human) Recombinant Protein
Contáctenos
Información del producto
Human FGF23 recombinant protein with His tag in N-terminus expressed in
Escherichia coli
.
Información adicional
Size
2 x 10 ug
Gene Name
FGF23
Gene Alias
ADHR|HPDR2|HYPF|PHPTC
Gene Description
fibroblast growth factor 23
Storage Conditions
Lyophilized protein should be stored at -20ºC. Protein aliquots at 4ºC for 2 weeks.
Avoid repeated freeze/thaw cycles.
Immunogen Prot. Seq
MKHHHHHHASAEDDSERDPLNVLKPRARMTPAPASCSQELPSAEDNSPMASDPLGVVRGGRVNTHAGGTGPEGCRPFAKFI
Form
Lyophilized
Antigen species Target species
Human
Storage Buffer
Protein (0.5 mg/mL) was lyophilized from a solution containing 20 mM Tris, pH 7.5, 50 mM NaCl. Reconstitute the lyophilized powder in ddH
2
O to 0.5 mg/mL, and is not sterile! Please filter the product by an sterile filter before use.
Gene ID
8074
Enviar un mensaje
FGF23 (Human) Recombinant Protein
Nombre
*
Apellidos
*
Correo electrónico
*
Centro de Investigación
*
Departamento
Teléfono de Contacto
*
Mensaje de consulta sobre el producto
*